I used vpn method to unblock the site, Thank you very much bro, method 1 Changing DNS Server settings worked, Sorry, But nothing is going to work because it blocks the proxies too, and the rest of the websites, Your email address will not be published. "truncateBody" : "true", G'day I was hoping to figure out how to find out which clients are triggeringthe below. "event" : "addMessageUserEmailSubscription", { "event" : "RevokeSolutionAction", "event" : "ProductMessageEdit", "event" : "deleteMessage", ] }, "context" : "", Make sure to clear the browser cache. { ] This technique is found to be very effective to use. LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'ier9-S88if7nxKrhiWdi-Nic2b5lv0aPjwHEUBM8u10. dataType: 'html', "event" : "AcceptSolutionAction", { Welcome to the Snap! var possible = "ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789"; { { "event" : "ProductAnswerComment", } This article covers troubleshooting steps for resolving issues that are commonly experienced when using content filtering. ] })(LITHIUM.jQuery); // Pull in global jQuery reference If this works, it is likely that the URL pattern blockdoesn't match the destination. "action" : "rerender" "actions" : [ "kudosable" : "true", "actions" : [ Why is my site labeled as dangerous in Google Search? { console.log('Submitting header search form'); "actions" : [ ] "actions" : [ } If it doesnt fall within legal regulations, the ISP might block it without prior notice. If you have a website that is marked as malicious when it should not be, you can submit a URL reputation change request and/or an IP reputation change request. LITHIUM.DropDownMenu({"userMessagesFeedOptionsClass":"div.user-messages-feed-options-menu a.lia-js-menu-opener","menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","userMessagesFeedOptionsAriaLabel":"Show contributions of the user, selected option is null. Though the ISP speed would drop significantly but had no other options. $('body').on({ url: '/plugins/custom/cisco/meraki/profile-card?tid=-7108421038949464961', }, "actions" : [ } These services create a secure channel fooling the ISPs and giving you anonymity to use the blocked websites. Blocked URL patterns: Blocked URL patterns could match with the site you are attempting to reach. } }, }, "}); ] { }, } "event" : "AcceptSolutionAction", LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] Hence, you need to replace the URL with the IP address at each step. Therefore, your ISP will not know what youre up to. "event" : "markAsSpamWithoutRedirect", "parameters" : { "componentId" : "kudos.widget.button", "action" : "rerender" Refer tothe, Make sure that the client you are configuring is not blocked. The more vague a block pattern is, the more likely it is to block the entire domain. "initiatorBinding" : true, "actions" : [ ] LITHIUM.AjaxSupport.ComponentEvents.set({ }, "context" : "", "context" : "envParam:quiltName,message", "action" : "pulsate" Group policy rules always take priority over default network rules. { { "action" : "addClassName" "context" : "envParam:selectedMessage", none of this worked for me, all the recomendations where blocked by the administrator ironically, They blocked downloading anything other than pdfs and stuff like that. "event" : "unapproveMessage", Make sure the syntax for the URL pattern is correct. The content filtering feature is available only with an Advanced Security license. "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" "context" : "", The list of website categories is hosted by BrightCloud. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_4","componentSelector":"#threadeddetaildisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":10599,"confimationText":"You have other message editors open and your data inside of them might be lost. Domain names to whitelist on upstream firewall. Category filtering provides a list of categories thatcan be selected to block all web traffic destined to a URL/IP that matches with these categories on a hosted list. ] "context" : "envParam:selectedMessage", { Are there more than one icon/button? Here're the steps to unblock websites that are blocked by extensions: Click on the Extensions icon on your browser (top right corner) Then, locate website-blocking extensions. } "actions" : [ } Edit: From your image, it looks like you do not have anything setup for content filtering anyway. "disallowZeroCount" : "false", $('.hc-user-profile').removeClass('hc-animate-in hc-is-shown'); "action" : "rerender" "actions" : [ "selector" : "#kudosButtonV2", To block a specific website or page, add the URL pattern for the webpage under URL Blocking > Blocked URL Patterns. By rejecting non-essential cookies, Reddit may still use certain cookies to ensure the proper functionality of our platform. } Any content of an adult theme or inappropriate to a community web site. There are chances that youre network admin can trace that youre accessing blocked website depending on network level and firewall. "selector" : "#messageview_2", } "action" : "rerender" "event" : "RevokeSolutionAction", To answer your question though, it is probably by MAC Address that is the piece of data used to recognise the device by a network. "actions" : [ } You will also be able to see whichIP address and URL arebeing blocked. "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ }, Are you sure you want to proceed? "This website is blocked by your nework operator" I still use the Ultrasurf app on my mobile to connect with any public Wi-Fi for security and privacy. } }, "disableLabelLinks" : "false", Many a time while browsing any website you may encounter with Site was blocked by Network Administrator error. { Know that, for this method, you need to be connected to the WiFi via the password. } { How do ISPs block sites & how to access them anyway This is working across my entire network as expected. { "context" : "", }, "event" : "removeThreadUserEmailSubscription", ] }, Are you sure you want to proceed? ] Auto-suggest helps you quickly narrow down your search results by suggesting possible matches as you type. } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_3","componentSelector":"#threadeddetaildisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":10505,"confimationText":"You have other message editors open and your data inside of them might be lost. "initiatorBinding" : true, Check for Web search filtering, Blocked URL patterns and Blocked Website Categories. "selector" : "#messageview", "context" : "", { "actions" : [ 5 Ways to Bypass Internet Censorship and Filtering Content filtering can be used to filter content passing through your security appliance based on content known to exist on specified web pages. "useSimpleView" : "false", "parameters" : { }, Its all sorted now i got my hands on a low orbit ion cannon (LOIC) (DDOS) tool which got it back. "context" : "envParam:quiltName,message,product,contextId,contextUrl", @ITPointeMan If you export the log to a CSV you should be able to filter these down in Excel. }, "event" : "addMessageUserEmailSubscription", Usually this happens when the IP has a bad reputation but the URL reputation is good. } Fix them with this tool: If the advices above haven't solved your issue, your PC may experience deeper Windows problems. { "disallowZeroCount" : "false", If any of the below methods are working, then you can skip the rest. Blocked Sites / Summary Report - The Meraki Community { LITHIUM.HelpIcon({"selectors":{"helpIconSelector":".help-icon .lia-img-icon-help"}}); "action" : "rerender" ] For example, If I have a percentage of sites being blocked by the "Adult and Pornography" filter, can I filter specifically for that category in the event log? ","disabledLink":"lia-link-disabled","menuOpenCssClass":"dropdownHover","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","messageOptions":"lia-component-message-view-widget-action-menu","menuBarComponent":"lia-component-menu-bar","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened","pageOptions":"lia-component-community-widget-page-options","clickElementSelector":".lia-js-click-menu","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed"}); How to Fix Spotify Web Player Not Working on Safari Mac? "action" : "rerender" In this case, you need to check your router. "event" : "addMessageUserEmailSubscription", }, ] You may also try connecting with some other freely available DNS IP address to check if anything else works. "context" : "", { "componentId" : "kudos.widget.button", ] ], "action" : "addClassName" Please note that HTTPS requests will not result in a block page, refer to the Troubleshooting section for more details. "useSubjectIcons" : "true", "action" : "pulsate" "action" : "rerender" "actions" : [ mouseenter: function(evt) { } Refer to the article on web search filteringforinformation. { { }, "selector" : "#kudosButtonV2_2", } { "action" : "rerender" "includeRepliesModerationState" : "true", "message" : "10199", { However, its borderline infuriating when you cant access a website specifically from your home. "actions" : [ "actions" : [ Here is my question: I have MX80. { { }, "eventActions" : [ "actions" : [ Blocked Sites / Summary Report. "context" : "envParam:quiltName,message,product,contextId,contextUrl", How to bypass the "universal" website ban on netwrok : r/meraki - Reddit Instructions for doing so are available on the following KB Article - Creating a Layer 7 Firewall Rule. ] LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { "messageViewOptions" : "1101110111111111111110111110100101111101", "action" : "rerender" { } "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); Fix: This Network Is Blocking Encrypted DNS Traffic $(this).on('click', function() { }, Start your free trial Three clicks to secure SD-WAN. "truncateBodyRetainsHtml" : "false", { "action" : "rerender" Step 3: Ban TikTok from Router Settings That's it! "event" : "ProductAnswer", { I have a situation that I need some guidance on. "action" : "rerender" To do so follow the steps below. }, "messageViewOptions" : "1111110111111111111110111110100101011101", "context" : "envParam:quiltName", "entity" : "10200", }, "initiatorBinding" : true, "selector" : "#kudosButtonV2_1", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_e2e384343fe895","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_e2e384343fe895_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/security/message-id/2507/thread-id/2507&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"oyjlP6Ud3jgIY8iRVOEePh_BownWdRjWO8SSFjQibgY. ] "truncateBodyRetainsHtml" : "false", -Go to Settings. Meraki Partner of the Month chat with Cloud4Wi, Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_e2e384343fe895_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/message-id/2507/thread-id/2507&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"});
														
						
															